CDKN1A monoclonal antibody (M02), clone 2F1

• Catalog Number: orb2294588
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDKN1A.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CDKN1A (AAH00312.1, 65 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
• Tested applications: ELISA, IF, PLA, WB
• Clone Number: 2F1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH00312.1

CDKN1A monoclonal antibody (M02), clone 2F1. Western Blot analysis of CDKN1A expression in human liver.

Detection limit for recombinant GST tagged CDKN1A is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CDKN1A on HeLa cell. [antibody concentration 10 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between CASP3 and CDKN1A. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-CDKN1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).