You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
CDK9 monoclonal antibody (M07), clone 2D7
Catalog Number: orb2294592
| Catalog Number | orb2294592 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant CDK9. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2a Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | CDK9 (AAH01968, 271 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF |
| Tested applications | ELISA, IF, WB |
| Clone Number | 2D7 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | AAH01968 |
Western Blot detection against Immunogen (36.96 KDa).
Detection limit for recombinant GST tagged CDK9 is approximately 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CDK9 on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot analysis of CDK9 expression in transfected 293T cell line by CDK9 monoclonal antibody (M07), clone 2D7. Lane 1: CDK9 transfected lysate(42.778 KDa). Lane 2: Non-transfected lysate.
