You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294611 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CDK5 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IP, WB |
Reactivity | Human |
Immunogen | CDK5 (NP_004926.1, 1 a.a. ~ 292 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP |
NCBI | NP_004926.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | No additive |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CDK5 MaxPab rabbit polyclonal antibody. Western Blot analysis of CDK5 expression in HeLa.
Immunoprecipitation of CDK5 transfected lysate using anti-CDK5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDK5 MaxPab mouse polyclonal antibody (B01).
Western Blot analysis of CDK5 expression in transfected 293T cell line by CDK5 MaxPab polyclonal antibody. Lane 1: CDK5 transfected lysate(33.3 KDa). Lane 2: Non-transfected lysate.