CDK4 monoclonal antibody (M05), clone 2A1

• Catalog Number: orb2294620
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDK4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Tested applications: ELISA, WB
• Clone Number: 2A1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH03644

CDK4 monoclonal antibody (M05), clone 2A1 Western Blot analysis of CDK4 expression in HeLa.

CDK4 monoclonal antibody (M05), clone 2A1. Western Blot analysis of CDK4 expression in NIH/3T3.

CDK4 monoclonal antibody (M05), clone 2A1. Western Blot analysis of CDK4 expression in Raw 264.7.

Detection limit for recombinant GST tagged CDK4 is approximately 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (35.97 KDa).