You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294621 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CDK4. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2G7 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Mouse |
Isotype | IgG1 Kappa |
Immunogen | CDK4 (AAH03644, 211 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
NCBI | AAH03644 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CDK4 monoclonal antibody (M04), clone 2G7 Western Blot analysis of CDK4 expression in HeLa.
CDK4 monoclonal antibody (M04), clone 2G7. Western Blot analysis of CDK4 expression in NIH/3T3.
CDK4 monoclonal antibody (M04), clone 2G7. Western Blot analysis of CDK4 expression in Raw 264.7.
Detection limit for recombinant GST tagged CDK4 is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CDK4 on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot detection against Immunogen (35.97 KDa).