CDK2 monoclonal antibody (M02), clone 2E8

• Catalog Number: orb2294628
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDK2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CDK2 (AAH03065, 211 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
• Tested applications: ELISA, WB
• Clone Number: 2E8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH03065

CDK2 monoclonal antibody (M02), clone 2E8 Western Blot analysis of CDK2 expression in HL-60.

CDK2 monoclonal antibody (M02), clone 2E8. Western Blot analysis of CDK2 expression in Jurkat.

Detection limit for recombinant GST tagged CDK2 is approximately 0.03 ng/ml as a capture antibody.

Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody (M02), clone 2E8. Lane 1: CDK2 transfected lysate(33.9 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody (M02) clone 2E8 (Cat # orb2294628). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.42 KDa).