You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294628 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CDK2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CDK2 (AAH03065, 211 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL |
Tested applications | ELISA, WB |
Clone Number | 2E8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH03065 |
CDK2 monoclonal antibody (M02), clone 2E8 Western Blot analysis of CDK2 expression in HL-60.
CDK2 monoclonal antibody (M02), clone 2E8. Western Blot analysis of CDK2 expression in Jurkat.
Detection limit for recombinant GST tagged CDK2 is approximately 0.03 ng/ml as a capture antibody.
Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody (M02), clone 2E8. Lane 1: CDK2 transfected lysate(33.9 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody (M02) clone 2E8 (Cat # orb2294628). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (35.42 KDa).