CDH18 monoclonal antibody (M01), clone 6F7

• Catalog Number: orb2294632
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDH18.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6F7
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CDH18 (NP_004925, 467 a.a. ~ 576 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DLLSHVTVGIRVLDVNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIP
• NCBI: NP_004925
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CDH18 monoclonal antibody (M01), clone 6F7 Western Blot analysis of CDH18 expression in HeLa.

Detection limit for recombinant GST tagged CDH18 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CDH18 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml].

Western Blot detection against Immunogen (37.84 KDa).