CDH1 monoclonal antibody (M01), clone 3F4

• Catalog Number: orb2294686
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDH1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
• Tested applications: ELISA, IHC-P, PLA, WB
• Clone Number: 3F4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004351

CDH1 monoclonal antibody (M01), clone 3F4. Western Blot analysis of CDH1 expression in human kidney.

Detection limit for recombinant GST tagged CDH1 is 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CDH1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.375 ug/ml].

Proximity Ligation Analysis of protein-protein interactions between EGFR and CDH1. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-CDH1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).