You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294686 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CDH1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV |
Tested applications | ELISA, IHC-P, PLA, WB |
Clone Number | 3F4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004351 |
CDH1 monoclonal antibody (M01), clone 3F4. Western Blot analysis of CDH1 expression in human kidney.
Detection limit for recombinant GST tagged CDH1 is 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to CDH1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.375 ug/ml].
Proximity Ligation Analysis of protein-protein interactions between EGFR and CDH1. HeLa cells were stained with anti-EGFR rabbit purified polyclonal 1:1200 and anti-CDH1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.74 KDa).