CDC5L polyclonal antibody (A01)

• Catalog Number: orb2294709
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant CDC5L.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human
• Immunogen: CDC5L (NP_001244, 719 a.a. ~ 802 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: ILLGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSKF
• NCBI: NP_001244
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CDC5L polyclonal antibody (A01), Western Blot analysis of CDC5L expression in Jurkat.

CDC5L polyclonal antibody (A01), Western Blot analysis of CDC5L expression in 293.

Western Blot detection against Immunogen (35.35 KDa).