CDC42EP2 monoclonal antibody (M01), clone 2H7

• Catalog Number: orb2291570
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDC42EP2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2H7
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CDC42EP2 (NP_006770, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
• NCBI: NP_006770
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 monoclonal antibody (M01), clone 2H7. Lane 1: CDC42EP2 transfected lysate (22.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).