CDC25C monoclonal antibody (M01A), clone 3B11

• Catalog Number: orb2294691
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CDC25C.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B11
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
• NCBI: AAH19089
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CDC25C monoclonal antibody (M01A), clone 3B11 Western Blot analysis of CDC25C expression in HeLa.

Western Blot analysis of CDC25C expression in transfected 293T cell line by CDC25C monoclonal antibody (M01A), clone 3B11. Lane 1: CDC25C transfected lysate(53.312 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).