You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402348 |
---|---|
Category | Antibodies |
Description | Cdc20 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, IHC-Fr, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 55 kDa |
UniProt ID | Q12834 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Cell division cycle protein 20 homolog; p55CDC; CD Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U20S cells using anti-Cdc20 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of SiHa cells using anti-Cdc20 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of Cdc20 using anti-Cdc20 antibody.Lane 1:human HeLa cell.
IF analysis of Cdc20 using anti-Cdc20 antibody.Cdc20 was detected in immunocytochemical section of NIH3T3 cell.
IHC analysis of Cdc20 using anti-Cdc20 antibody.Cdc20 was detected in paraffin-embedded section of human colon cancer tissue.
IHC analysis of Cdc20 using anti-Cdc20 antibody.Cdc20 was detected in paraffin-embedded section of human lung cancer tissue.
IHC analysis of Cdc20 using anti-Cdc20 antibody.Cdc20 was detected in paraffin-embedded section of mouse small intestine tissue.
IHC analysis of Cdc20 using anti-Cdc20 antibody.Cdc20 was detected in paraffin-embedded section of rat small intestine tissue.
IHC analysis of Cdc20 using anti-Cdc20 antibody.Cdc20 was detected in paraffin-embedded section of human mammary cancer tissue.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating