CD8A purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2294921
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CD8A protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CD8A (AAH25715.1, 1 a.a. ~ 235 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
• NCBI: AAH25715.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CD8A MaxPab polyclonal antibody. Western Blot analysis of CD8A expression in human spleen.

Western Blot analysis of CD8A expression in transfected 293T cell line by CD8A MaxPab polyclonal antibody. Lane 1: CD8A transfected lysate(25.85 KDa). Lane 2: Non-transfected lysate.