You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294919 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant CD8A. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CD8A (AAH25715, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV |
Tested applications | ELISA, IF, IP |
Clone Number | 4B9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH25715 |
Detection limit for recombinant GST tagged CD8A is approximately 3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CD8A on HeLa cell. [antibody concentration 40 ug/ml].
Immunoprecipitation of CD8A transfected lysate using anti-CD8A monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD8A MaxPab rabbit polyclonal antibody.