CD83 monoclonal antibody (M01), clone 3G10-1F4

• Catalog Number: orb2291739
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant CD83.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CD83 (AAH30830, 1 a.a. ~ 205 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
• Tested applications: ELISA, IP, WB
• Clone Number: 3G10-1F4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH30830

CD83 monoclonal antibody (M01), clone 3G10-1F4. Western Blot analysis of CD83 expression in human colon.

Detection limit for recombinant GST tagged CD83 is approximately 0.3 ng/ml as a capture antibody.

Immunoprecipitation of CD83 transfected lysate using anti-CD83 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD83 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CD83 expression in transfected 293T cell line by CD83 monoclonal antibody (M01), clone 3G10-1F4. Lane 1: CD83 transfected lysate (Predicted MW: 23 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (48.29 KDa).