You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
CD74 purified MaxPab rabbit polyclonal antibody (D01P)
Catalog Number: orb2294733
| Catalog Number | orb2294733 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human CD74 protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | PLA, WB |
| Reactivity | Human |
| Immunogen | CD74 (NP_001020329.1, 1 a.a. ~ 160 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV |
| NCBI | NP_001020329.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Proximity Ligation Analysis of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with anti-CD74 rabbit purified polyclonal 1:1200 and anti-HLA-DQA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of CD74 expression in transfected 293T cell line by CD74 MaxPab polyclonal antibody. Lane 1: CD74 transfected lysate(18.30 KDa). Lane 2: Non-transfected lysate.
