You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294737 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CD69. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CD69 (AAH07037, 90 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK |
Tested applications | ELISA, IP |
Clone Number | 4H3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH07037 |
Detection limit for recombinant GST tagged CD69 is 1 ng/ml as a capture antibody.
Immunoprecipitation of CD69 transfected lysate using anti-CD69 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD69 MaxPab rabbit polyclonal antibody.