CD5L monoclonal antibody (M01), clone 1C8

• Catalog Number: orb2294927
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CD5L.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CD5L (AAH33586, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
• Tested applications: ELISA, IP, WB
• Clone Number: 1C8
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH33586

CD5L monoclonal antibody (M01), clone 1C8. Western Blot analysis of CD5L expression in different cell lines.

CD5L monoclonal antibody (M01), clone 1C8. Western Blot analysis of CD5L expression in HL-60.

Detection limit for recombinant GST tagged CD5L is approximately 0.3 ng/ml as a capture antibody.

Immunoprecipitation of CD5L transfected lysate using anti-CD5L monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD5L MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (36.63 KDa).