CD5 monoclonal antibody (M01), clone 2F7

• Catalog Number: orb2294932
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CD5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F7
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CD5 (ABM83003, 403 a.a. ~ 495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPDNSSDSDYDLHGAQRL
• NCBI: ABM83003
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CD5 monoclonal antibody (M01), clone 2F7. Western Blot analysis of CD5 expression in K-562.

Detection limit for recombinant GST tagged CD5 is 0.3 ng/ml as a capture antibody.

Western Blot analysis of CD5 expression in transfected 293T cell line by CD5 monoclonal antibody (M01), clone 2F7. Lane 1: CD5 transfected lysate (Predicted MW: 36.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.86 KDa).