You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334581 |
---|---|
Category | Antibodies |
Description | CD46 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Mouse |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Mouse |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 40881 MW |
UniProt ID | O88174 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Membrane cofactor protein;CD46;Cd46;Mcp; Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of CD46 using anti-CD46 antibody.Lane 1:mouse testis tissue;2:NIH/3T3 cell.
FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating