You have no items in your shopping cart.
Cart summary
CD3G Protein, Cynomolgus, Recombinant (His)
Catalog Number: orb1977485
| Catalog Number | orb1977485 |
|---|---|
| Category | Proteins |
| Description | CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 12.5 kDa (predicted) |
| UniProt ID | Q95LI7 |
| Protein Sequence | QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Cynomolgus |
| Biological Activity | CD3G Protein, Cynomolgus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.5 kDa and the accession number is Q95LI7. |
| Expression Region | 23-113 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
Recombinant Cynomolgus CD3E&CD3G Protein, hFc His Tag [orb1550354]
> 95% by SDS-PAGE.
Recombinant Human BCMA/TNFRSF17 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Gln23-Thr113 (Q95LI7) ) of cynomolgus CD3E&CD3G (Accession #Q95LI5.2 & Q95LI7) fused with an Fc tag at the C-terminus.
100 μgRecombinant Cynomolgus CD3E&CD3G Protein, Fc His Tag [orb1551231]
> 95% by SDS-PAGE.
Recombinant Human BCMA/TNFRSF17 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Gln23-Thr113 (Q95LI7) ) of cynomolgus CD3E&CD3G (Accession #Q95LI5.2 & Q95LI7) fused with an Fc tag at the C-terminus.
1000 μg
