You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb251554 |
---|---|
Category | Antibodies |
Description | CD36 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By HeatWestern blot, 0.1-0.5μg/ml, Human, Mouse, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 53053 MW |
UniProt ID | P16671 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Platelet glycoprotein 4;Fatty acid translocase;FAT Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
IHC(P) analysis of Rat Spleen Tissue using Anti-CD36 Picoband antibody.
Western blot analysis using Anti-CD36 Picoband antibody.Lane 1:Rat Liver Tissue;2:Rat Cardiac Muscle Tissue;3:Mouse Liver Tissue;4:Mouse Cardiac Muscle Tissue;5:SMMC Cell.
IHC analysis of Galectin 1 using anti-Galectin 1 antibody.Galectin 1 was detected in paraffin-embedded section of human Lung cancer tissues.
Filter by Rating