You have no items in your shopping cart.
Cart summary
CD300LB Protein, Human, Recombinant (His)
Catalog Number: orb1978808
| Catalog Number | orb1978808 |
|---|---|
| Category | Proteins |
| Description | Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. CD300LB Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is A8K4G0. |
| Tag | N-10xHis |
| Purity | 98.00% |
| MW | 18.8 kDa (predicted) |
| UniProt ID | A8K4G0 |
| Protein Sequence | IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. CD300LB Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is A8K4G0. |
| Expression Region | 18-151 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
