CD272/BTLA Antibody

• Catalog Number: orb526985
• Category: Antibodies
• Description: CD272/BTLA Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 65 kDa
• UniProt ID: Q7Z6A9
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: B- and T-lymphocyte attenuator; B- and T-lymphocyt
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of THP-1 cells using anti-CD272/BTLA antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of CD272 using anti-CD272 antibody.Lane 1:human HEK293 Cell;2:human Jurkat Cell;3:human CCRF-CEM Cell;4:mouse thymus Tissue.

IHC analysis of CD272/BTLA using anti-CD272/BTLA antibody.CD272/BTLA was detected in paraffin-embedded section of human tonsil tissues.

IHC analysis of CD272/BTLA using anti-CD272/BTLA antibody.CD272/BTLA was detected in paraffin-embedded section of mouse spleen tissues.

IHC analysis of CD272/BTLA using anti-CD272/BTLA antibody.CD272/BTLA was detected in paraffin-embedded section of mouse spleen tissues.