You have no items in your shopping cart.
Cart summary
Cd248 Peptide - middle region
Catalog Number: orb2005622
| Catalog Number | orb2005622 |
|---|---|
| Category | Proteins |
| Description | Cd248 Peptide - middle region |
| Tested applications | WB |
| Predicted Reactivity | Human, Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 82kDa |
| UniProt ID | Q91V98 |
| Protein Sequence | Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF |
| NCBI | NP_473383 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | 2610111G01Rik, AI842296, Cd164l1, Tem1 Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with Cd248 Rabbit Polyclonal Antibody (orb584502). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
