CD247 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2294935
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CD247 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: PLA, WB
• Reactivity: Human, Mouse, Rat
• Immunogen: CD247 (NP_932170.1, 1 a.a. ~ 164 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
• NCBI: NP_932170.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in IMR-32.

CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse brain.

CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse kidney.

CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in rat brain.

CD247 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD247 expression in Raw 264.7.

Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of CD247 expression in transfected 293T cell line by CD247 MaxPab polyclonal antibody. Lane 1: CD247 transfected lysate(18.70 KDa). Lane 2: Non-transfected lysate.