You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291190 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human CD209 protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse |
Immunogen | CD209 (NP_066978.1, 1 a.a. ~ 404 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |
NCBI | NP_066978.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CD209 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD209 expression in human liver.
CD209 MaxPab rabbit polyclonal antibody. Western Blot analysis of CD209 expression in mouse liver.
Western Blot analysis of CD209 expression in transfected 293T cell line by CD209 MaxPab polyclonal antibody. Lane 1: CD209 transfected lysate(45.80 KDa). Lane 2: Non-transfected lysate.