CD177 monoclonal antibody (M01), clone 4C4

• Catalog Number: orb2290953
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CD177.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CD177 (AAH29167, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLW
• Tested applications: ELISA, IHC-P, IP, WB
• Clone Number: 4C4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH29167
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CD177 is approximately 3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CD177 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]

Immunoprecipitation of CD177 transfected lysate using anti-CD177 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD177 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CD177 expression in transfected 293T cell line by CD177 monoclonal antibody (M01), clone 4C4. Lane 1: CD177 transfected lysate(46.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).