You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291530 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CCT7. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1D6 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG1 kappa |
Immunogen | CCT7 (AAH19296, 425 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD |
NCBI | AAH19296 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CCT7 monoclonal antibody (M01), clone 1D6 Western Blot analysis of CCT7 expression in HL-60.
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in 293.
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in human pancreas.
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in K-562.
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in NIH/3T3.
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in PC-12.
CCT7 monoclonal antibody (M01), clone 1D6. Western Blot analysis of CCT7 expression in Raw 264.7.
Detection limit for recombinant GST tagged CCT7 is approximately 0.3 ng/ml as a capture antibody.
Western Blot analysis of CCT7 expression in transfected 293T cell line by CCT7 monoclonal antibody (M01), clone 1D6. Lane 1: CCT7 transfected lysate(59.4 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.07 KDa).