CCS monoclonal antibody (M03), clone 1E2

• Catalog Number: orb2291646
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CCS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E2
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CCS (NP_005116, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
• NCBI: NP_005116
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CCS is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CCS on HeLa cell. [antibody concentration 40 ug/ml]

Immunoperoxidase of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]

Immunoprecipitation of CCS transfected lysate using anti-CCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCS monoclonal antibody.

Western Blot analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2. Lane 1: CCS transfected lysate (Predicted MW: 29 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).