You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291646 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CCS. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1E2 |
Tested applications | ELISA, IF, IHC-P, IP, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | CCS (NP_005116, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
NCBI | NP_005116 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged CCS is 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CCS on HeLa cell. [antibody concentration 40 ug/ml]
Immunoperoxidase of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]
Immunoprecipitation of CCS transfected lysate using anti-CCS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCS monoclonal antibody.
Western Blot analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2. Lane 1: CCS transfected lysate (Predicted MW: 29 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).