CCR3 Antibody

• Catalog Number: orb413084
• Category: Antibodies
• Description: CCR3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55 kDa
• UniProt ID: P51677
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of RAW264.7 cells using anti-CCR3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of CCR3 using anti-CCR3 antibody.Lane 1:human Jurkat cell;2:human HepG2 cell;3:human MCF-7 cell;4:human U-87MG cell;5:human CCRF-CEM cell;6:rat brain tissue;7:mouse brain tissue;8:mouse testis tissue.