You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb413084 |
---|---|
Category | Antibodies |
Description | CCR3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human CCR3 (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Flow Cytometry, 1-3μg/1x106 cells |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 55 kDa |
UniProt ID | P51677 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of RAW264.7 cells using anti-CCR3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of CCR3 using anti-CCR3 antibody.Lane 1:human Jurkat cell;2:human HepG2 cell;3:human MCF-7 cell;4:human U-87MG cell;5:human CCRF-CEM cell;6:rat brain tissue;7:mouse brain tissue;8:mouse testis tissue.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating