You have no items in your shopping cart.
Cart summary
Item 1 of 1
CCR2 polyclonal antibody (A01)
Catalog Number: orb2294314
| Catalog Number | orb2294314 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant CCR2. |
| Clonality | Polyclonal |
| Species/Host | Mouse |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | 50 % glycerol |
| Immunogen | CCR2 (NP_000639, 1 a.a. ~ 42 a.a) partial recombinant protein with GST tag. |
| Protein Sequence | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
| Tested applications | ELISA, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_000639 |
| Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (30.73 KDa).
