CCR2 monoclonal antibody (M01), clone 4D12

• Catalog Number: orb2294313
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CCR2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgM Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CCR2 (NP_000639, 1 a.a. ~ 42 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
• Tested applications: ELISA, WB
• Clone Number: 4D12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000639
• Expiration Date: 12 months from date of receipt.

CCR2 monoclonal antibody (M01), clone 4D12 Western Blot analysis of CCR2 expression in HepG2.

Western Blot detection against Immunogen (30.36 KDa).