You have no items in your shopping cart.
Cart summary
CCL25 Protein, Mouse, Recombinant
Catalog Number: orb2815984
| Catalog Number | orb2815984 |
|---|---|
| Category | Proteins |
| Description | CCL25 Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O35903. |
| Tag | Tag Free |
| MW | 14.1 kDa (Predicted) |
| UniProt ID | O35903 |
| Protein Sequence | QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Expression Region | 24-144 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Mouse CCL25 protein (Active) [orb359119]
> 95% as determined by SDS-PAGE and HPLC.
14.1 kDa
E.Coli
500 μg, 5 μg, 100 μg - Item 1 of 1
Mouse Ccl25 protein [orb603966]
Greater than 90% as determined by SDS-PAGE.
18 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Murine TECK protein [orb107807]
HPLC, SDS-PAGE
Unconjugated
> 95% by SDS-PAGE and HPLC analyses.
14.1 kDa
5 μg, 100 μg, 500 μg Recombinant Mouse C-C motif chemokine 25 protein(Ccl25) (Active) [orb1650805]
500 μg, 20 μg, 100 μg, 1 mg, 5 μg, 250 μgMouse TECK Protein [orb428782]
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
5 μg, 20 μg, 1 mg
