You have no items in your shopping cart.
Cart summary
CCL21c Protein, Mouse, Recombinant
Catalog Number: orb2815987
| Catalog Number | orb2815987 |
|---|---|
| Category | Proteins |
| Description | CCL21c Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is P86793. |
| Tag | Tag Free |
| MW | 12.1 kDa (Predicted) |
| UniProt ID | P86793 |
| Protein Sequence | SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Expression Region | 24-133 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Mouse Ccl21c Protein [orb1478080]
Greater than 85% as determined by SDS-PAGE.
25.0 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse Ccl21c Protein [orb1477803]
Greater than 85% as determined by SDS-PAGE.
12.8 kDa
E.coli
1 mg, 20 μg, 100 μg Recombinant Mouse C-C motif chemokine 21c protein(Ccl21c) (Active) [orb1650831]
5 μg, 100 μg, 1 mg, 20 μg, 250 μg, 500 μg
