CCL19/MIP-3b Protein, Mouse, Recombinant

• Catalog Number: orb2815989
• Category: Proteins
• Description: CCL19/MIP-3b Protein, Mouse, Recombinant is expressed in E. coli with Tag Free. The accession number is O70460.
• Tag: Tag Free
• MW: 9.2 kDa (Predicted)
• UniProt ID: O70460
• Protein Sequence: GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
• Expression System: E. coli
• Biological Origin: Mouse
• Expression Region: 26-108 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.