You have no items in your shopping cart.
Cart summary
CAV3 Recombinant Protein (Human)
Catalog Number: orb2051684
| Catalog Number | orb2051684 |
|---|---|
| Category | Proteins |
| Description | CAV3 Recombinant Protein (Human) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 44.3 kDa |
| UniProt ID | P56539 |
| Protein Sequence | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV |
| Source | E.coli |
| NCBI | NP_001225 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | caveolin-3;cavolin 3;LGMD1C;LQT9;M-caveolin;MPDT;R Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human CAV3 protein [orb54333]
Greater than 90% as determined by SDS-PAGE.
44.3 kDa
E.coli
20 μg, 100 μg, 1 mgCAV3 Recombinant Protein (Human) [orb2051685]
Greater than 90% as determined by SDS-PAGE.
44.3 kDa
E.coli
1 mgCAV3 Recombinant Protein (Human) [orb2051686]
Greater than 90% as determined by SDS-PAGE.
44.3 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
