You have no items in your shopping cart.
Cart summary
Item 1 of 1
Cathepsin G antibody
Catalog Number: orb333734
| Catalog Number | orb333734 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Cathepsin G |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Guinea pig, Human, Rat |
| Reactivity | Guinea pig, Human, Rat |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 27kDa |
| Target | CTSG |
| UniProt ID | P08311 |
| Protein Sequence | Synthetic peptide located within the following region: SYDPRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEV |
| NCBI | NP_001902 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti CATG antibody, anti Cathepsin G antibody, ant Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western blot analysis of THP-1 Whole Cell tissue using Cathepsin G antibody
- Item 1 of 10
Cathepsin G antibody [orb322976]
ELISA, IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 200 μg - Item 1 of 6
- Item 1 of 5
- Item 1 of 5
Cathepsin G antibody [orb539066]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 4
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars