You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978854 |
---|---|
Category | Proteins |
Description | Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. Cathepsin F Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is Q9UBX1. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 27.4 kDa (predicted) |
UniProt ID | Q9UBX1 |
Protein Sequence | PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD |
Expression System | E. coli |
Biological Origin | Human |
Biological Activity | Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. Cathepsin F Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.4 kDa and the accession number is Q9UBX1. |
Expression Region | 273-484 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |