You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295105 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CAST. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CAST (NP_001741.3, 582 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | QPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQ |
Tested applications | ELISA, IF, WB |
Clone Number | 2C5 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001741.3 |
CAST monoclonal antibody (M03), clone 2C5. Western Blot analysis of CAST expression in NIH/3T3.
Detection limit for recombinant GST tagged CAST is 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to CAST on HeLa cell. [antibody concentration 10 ug/ml].
Western Blot detection against Immunogen (35.42 KDa).