You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295092 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CASP3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CASP3 (AAH16926.1, 176 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH |
Tested applications | ELISA, PLA |
Clone Number | 4D3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH16926.1 |
Detection limit for recombinant GST tagged CASP3 is approximately 1 ng/ml as a capture antibody.
Proximity Ligation Analysis of protein-protein interactions between CASP6 and CASP3. HeLa cells were stained with anti-CASP6 rabbit purified polyclonal 1:1200 and anti-CASP3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).