CASP2 monoclonal antibody (M10), clone 1C11

• Catalog Number: orb2295095
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CASP2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C11
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CASP2 (AAH02427, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS
• NCBI: AAH02427
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to CASP2 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (36.63 KDa).