CASP14 monoclonal antibody (M01), clone 4C9

• Catalog Number: orb2291315
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CASP14.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CASP14 (NP_036246, 133 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RGEQRDPGETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ
• Tested applications: ELISA, IF, WB
• Clone Number: 4C9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_036246

CASP14 monoclonal antibody (M01), clone 4C9 Western Blot analysis of CASP14 expression in MCF-7.

Detection limit for recombinant GST tagged CASP14 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CASP14 on HeLa cell. [antibody concentration 15 ug/ml]

Western Blot detection against Immunogen (37.84 KDa).