Cart summary

You have no items in your shopping cart.

    Caseine Kinase 1 alpha/CSNK1A1 Antibody

    Catalog Number: orb316556

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb316556
    CategoryAntibodies
    DescriptionCaseine Kinase 1 alpha/CSNK1A1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    Predicted ReactivityGallus
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW38915 MW
    UniProt IDP48729
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesCasein kinase I isoform alpha;CKI-alpha;2.7.11.1;C
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    Caseine Kinase 1 alpha/CSNK1A1 Antibody

    WB analysis of CSNK1A1 using anti-CSNK1A1 antibody.Lane 1:Rat Brain Tissue;2:Rat Kidney Tissue;3:Mouse Kidney Tissue;4:HELA Cell.

    Caseine Kinase 1 alpha/CSNK1A1 Antibody

    IHC analysis of CSNK1A1 using anti-CSNK1A1 antibody.CSNK1A1 was detected in paraffin-embedded section of rat intestine tissues.

    Caseine Kinase 1 alpha/CSNK1A1 Antibody

    IHC analysis of CSNK1A1 using anti-CSNK1A1 antibody.CSNK1A1 was detected in paraffin-embedded section of human intestinal cancer tissues.

    Caseine Kinase 1 alpha/CSNK1A1 Antibody

    IHC analysis of CSNK1A1 using anti-CSNK1A1 antibody.CSNK1A1 was detected in paraffin-embedded section of mouse intestine tissues.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars