You have no items in your shopping cart.
Cart summary
Cardiac phospholamban/PLN Protein, Human, Recombinant (GST)
Catalog Number: orb1978865
| Catalog Number | orb1978865 |
|---|---|
| Category | Proteins |
| Description | Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 33.1 kDa and the accession number is P26678. |
| Tag | N-GST |
| Purity | 98.00% |
| MW | 33.1 kDa (predicted) |
| UniProt ID | P26678 |
| Protein Sequence | MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Cardiac phospholamban/PLN Protein, Human, Recombinant (GST) is expressed in yeast with N-GST tag. The predicted molecular weight is 33.1 kDa and the accession number is P26678. |
| Expression Region | 1-52 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
