CAPZB MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295104
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CAPZB protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CAPZB (AAH08095.1, 1 a.a. ~ 79 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MLNLCFMLTRHAVHSLDSFLRKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFCHTSLSVLSTFP
• NCBI: AAH08095.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CAPZB MaxPab polyclonal antibody. Western Blot analysis of CAPZB expression in human placenta.

Western Blot analysis of CAPZB expression in transfected 293T cell line by CAPZB MaxPab polyclonal antibody. Lane 1: CAPZB transfected lysate(8.69 KDa). Lane 2: Non-transfected lysate.