CAPS monoclonal antibody (M01), clone 4C6

• Catalog Number: orb2295114
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CAPS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CAPS (NP_004049, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSG
• NCBI: NP_004049
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CAPS is approximately 0.03 ng/ml as a capture antibody.

Western Blot analysis of CAPS expression in transfected 293T cell line by CAPS monoclonal antibody (M01), clone 4C6. Lane 1: CAPS transfected lysate(21 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CAPS over-expressed 293 cell line, cotransfected with CAPS Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPS monoclonal antibody (M01), clone 4C6 (Cat # orb2295114). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.73 KDa).