CAPRIN2 Rabbit Polyclonal Antibody

• Catalog Number: orb586667
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAPRIN2
• Target: CAPRIN2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Porcine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CAPRIN2
• Protein Sequence: Synthetic peptide located within the following region: FGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASP
• UniProt ID: Q6IMN6
• MW: 30kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: EEG1, EEG-1, C1QDC1, RNG140
• Note: For research use only

Sample Type: A549 Whole Cell lysates, Antibody dilution: 1.0 ug/ml. CAPRIN2 is supported by BioGPS gene expression data to be expressed in A549.