CAPNS1 monoclonal antibody (M01), clone 3C4

• Catalog Number: orb2295118
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CAPNS1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CAPNS1 (AAH00592, 172 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 3C4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH00592

CAPNS1 monoclonal antibody (M01), clone 3C4 Western Blot analysis of CAPNS1 expression in A-431.

CAPNS1 monoclonal antibody (M01), clone 3C4. Western Blot analysis of CAPNS1 expression in PC-12.

Detection limit for recombinant GST tagged CAPNS1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CAPNS1 on HeLa cell. [antibody concentration 20 ug/ml].

Immunoperoxidase of monoclonal antibody to CAPNS1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml].

Western Blot analysis of CAPNS1 expression in transfected 293T cell line by CAPNS1 monoclonal antibody (M01), clone 3C4. Lane 1: CAPNS1 transfected lysate(28.3 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPNS1 monoclonal antibody (M01), clone 3C4 (Cat # orb2295118). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.42 KDa).