You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290669 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CANT1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2D3 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | CANT1 (AAH17655, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVKYEGIEFI |
NCBI | AAH17655 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CANT1 monoclonal antibody (M01), clone 2D3 Western Blot analysis of CANT1 expression in A-431.
Detection limit for recombinant GST tagged CANT1 is approximately 0.1 ng/ml as a capture antibody.
Western Blot analysis of CANT1 expression in transfected 293T cell line by CANT1 monoclonal antibody (M01), clone 2D3. Lane 1: CANT1 transfected lysate(44.8 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).