CANT1 monoclonal antibody (M01), clone 2D3

• Catalog Number: orb2290669
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CANT1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CANT1 (AAH17655, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVKYEGIEFI
• NCBI: AAH17655
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CANT1 monoclonal antibody (M01), clone 2D3 Western Blot analysis of CANT1 expression in A-431.

Detection limit for recombinant GST tagged CANT1 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of CANT1 expression in transfected 293T cell line by CANT1 monoclonal antibody (M01), clone 2D3. Lane 1: CANT1 transfected lysate(44.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).